Commit 91194587 authored by Valentina Galata's avatar Valentina Galata
Browse files

notes: updated rgi/card other notes (issue #124)

parent f0ae27df
......@@ -2,190 +2,114 @@
Additional analysis focusing on AMR, i.e. RGI (CARD) results, in GDB.
File `amr.tsv`:
- table created using `workflow_report` (2021.01.28)
Based in file `amr.tsv`:
- table created using `workflow_report` (2021.03.10)
- all RGI hits to AROs which were found (non-nudged hits) in SR/Hy but **NOT** in LR
- `amr.xlsx`: annotated table
# ARO:3000194 and MMSEQS2 cluster
From `mmseqs2` results: cluster `operamsmetaspades__opera_contig_2775_1` contains:
- operamsmetaspades__opera_contig_2775_1
- metaspades__NODE_8958_length_2718_cov_51.879591_1
- raven__Utg193156:1.0-35862.0_56
- metaspadeshybrid__NODE_230_length_104252_cov_9.790458_35
- metaspadeshybrid__NODE_348_length_69013_cov_11.179239_18
- megahit__k141_88921_2
- operamsmegahit__opera_contig_1207_6
All, except for `raven__Utg193156:1.0-35862.0_56`, are **prefect** hits to `ARO:3000194` (tetW).
RGI hits for `raven__Utg193156:1.0-35862.0_56`: **strict** hit (not nudged), `ARO:3004442` (tet(W/N/W))
Both AROs are very similar: identity 95.1%, similarity 97.5%, no gaps.
Complete output is in `ARO3004442_ARO3000194_alignment.txt` (using (EMBOSS Needle)[https://www.ebi.ac.uk/Tools/psa/emboss_needle/]).
# Overview
**Conclusions**
- cluster contains only perfect hits for `ARO:3000194`, none of the strict/nudged hits
- outlier/exception: `raven__Utg193156:1.0-35862.0_56` which seem to represent a different, highly similar, ARO
- LR
- only nudged hits
- some hits have >=10x metaT cov.
- LR, Flye: `ARO:3002999`, `ARO:3004454` (see `notes/gdb_rgi_aro3004454_flye.md`)
- LR, Raven: `ARO:3002999`
- SR/HY
- only few nudged hits
- all AROs have at least one non-nudged hit in each assembly
- most hits are >= 10x cov. metaT cov, only two have ca. 7x
- `ARO:3004454` has no perfect hits in any assembly
- other two AROs at least one perfect hit in each assembly
# Hit contig_4930:1.0-5516.0_1 (LR, Flye), ARO:3004454
See in file `notes/gdb_rgi_aro3004454_flye.md`.
# Hit contig_820:1.0-90197.0_60/contig_820:1.0-90197.0_61 (LR, Flye), ARO:3000194
## CARD ARO
[ARO:3000194](https://card.mcmaster.ca/ontology/36333)
# ARO:3000194 and MMSEQS2 cluster
```bash
# getting cluster representative for the perfect hit in MEGAHIT
grep -P "\tmegahit__k141_88921_2$" /scratch/users/vgalata/gdb/results/analysis/mmseqs2/clusters.tsv
# operamsmetaspades__opera_contig_2773_1 megahit__k141_88921_2
# getting all cluster members
grep -P "^operamsmetaspades__opera_contig_2773_1\t" /scratch/users/vgalata/gdb/results/analysis/mmseqs2/clusters.tsv | cut -f2
# operamsmetaspades__opera_contig_2773_1
# flye__contig_70:1.0-89743.0_55
# metaspadeshybrid__NODE_230_length_104252_cov_9.790458_35
# metaspadeshybrid__NODE_348_length_69013_cov_11.179239_18
# metaspades__NODE_8958_length_2718_cov_51.879591_1
# operamsmegahit__opera_contig_1206_6
# megahit__k141_88921_2
```
>gb|CAA10975.1|+|tetW [Butyrivibrio fibrisolvens]
MKIINIGILAHVDAGKTTLTESLLYASGAISEPGSVEKGTTRTDTMFLERQRGITIQAAVTSFQWHRCKVNIVDTPGHMDFLAEVYRSLA
VLDGAILVISAKDGVQAQTRILFHALRKMNIPTVIFINKIDQAGVDLQSVVQSVRDKLSADIIIKQTVSLSPEIVLEENTDIEAWDAVIE
NNDELLEKYIAGEPISREKLAREEQQRVQDASLFPVYHGSAKNGLGIQPLMDAVTGLFQPIGEQGGAALCGSVFKVEYTDCGQRRVYLRL
YSGTLRLRDTVALAGREKLKITEMRIPSKGEIVRTDTAYQGEIVILPSDSVRLNDVLGDQTRLPRKRWREDPLPMLRTTIAPKTAAQRER
LLDALTQLADTDPLLRCEVDSITHEIILSFLGRVQLEVVSALLSEKYKLETVVKEPSVIYMERPLKAASHTIHIEVPPNPFWASIGLSVT
PLSLGSGVQYESRVSLGYLNQSFQNAVRDGIRYGLEQGLFGWNVTDCKICFEYGLYYSPVSTPADFRSLAPIVLEQALKESGTQLLEPYL
SFILYAPQEYLSRAYHDAPKYCATIETAQVKKDEVVFTGEIPARCIQAYRTDLAFYTNGRSVCLTELKGYQAAVGQPVIQPRRPNSRLDK
VRHMFQKVM
```
## Gene/protein
Proteins sequences:
- HY OPERA-MS (metaSPAdes): `opera_contig_2773_1`: the only perfect hit
- LR Flye: `contig_70:1.0-89743.0_55`: RGI hit to `ARO:3004442` (tet(W/N/W)) (strict hit, not nudged)
- HY metaSPAdes: `NODE_230_length_104252_cov_9.790458_35`: one of two perfect hits
- HY metaSPAdes: `NODE_348_length_69013_cov_11.179239_18`: one of two perfect hits
- SR metaSPAdes: `NODE_8958_length_2718_cov_51.879591_1`: the only pefect hit
- HY OPERA-MS (MEGAHIT): `opera_contig_1206_6`: the only pefect hit
- SR MEGAHIT: `k141_88921_2`: the only perfect hit
`ARO:3000194` and `ARO:3004442` are very similar: identity 608/639 (95.1%), similarity 623/639 (97.5%), no gaps.
From (EMBOSS Needle)[https://www.ebi.ac.uk/Tools/psa/emboss_needle/]:
```
>contig_820:1.0-90197.0_60 # 42580 # 43047 # -1 # ID=4927_60;partial=00;start_type=TTG;rbs_motif=AGGAG/GGAGG;rbs_spacer=11-12bp;gc_cont=0.528
MLSEKYKLETVVKEPSVIYMERPLKAASHTIHIEVPPNPFWASIGLSVTPLSLGSGVQYESRVSLGYLNQSFQNAVRDGIRYGLEQGLFGWNVTDCKICFEYGLYYSPVSTPADFRSLAPIVLEQALKESGTQLLEPYLSFIPLCAPGIPFQGLS*
>contig_820:1.0-90197.0_61 # 43382 # 44248 # -1 # ID=4927_61;partial=00;start_type=ATG;rbs_motif=GGAGG;rbs_spacer=5-10bp;gc_cont=0.529
MKIINIGILAHVDAGKTTLTESLLYASGAISEPGSVEKGTTRTDTMFLERQRGITIQAAVTSFQWHRCKVNIVDTPGHMDFLAEVYRSLAVLDGAILVISAKDGVQAQTRILFHALRKMNIPTVIFINKIDQAGVDLQSVVQSVRDKLSADIIIKQTVSLSPEIVLEENTDIEAWDAVIENNDELLEKYIAGEPISREKLAREEQQRVQDASLFPVYHGSAKNGLGIQPLMDAVTGLFQPIGEQGAPPHAAAFSRLSTPIAASGVSIYGYTAERCACGIRWPWPGEKS*
```
+ 1 MKIINIGILAHVDAGKTTLTESLLYASGAISEPGSVEKGTTRTDTMFLER 50
||||||||||||||||||||||||||||||||||||||||||||||||||
+ 1 MKIINIGILAHVDAGKTTLTESLLYASGAISEPGSVEKGTTRTDTMFLER 50
When translating a part of the contig containing both genes:
- contig_820:1.0-90197.0_60: 3'5' frame 1 (-1 strand)
- contig_820:1.0-90197.0_61: 3'5' frame 3 (-1 strand)
+ 51 QRGITIQAAVTSFQWHRCKVNIVDTPGHMDFLAEVYRSLAVLDGAILVIS 100
||||||||||||||||||||||||||||||||||||||||||||||||||
+ 51 QRGITIQAAVTSFQWHRCKVNIVDTPGHMDFLAEVYRSLAVLDGAILVIS 100
## MSA w/ CARD ARO
+ 101 AKDGVQAQTRILFHALRKMNIPTVIFINKIDQAGVDLQSVYQSVRDKLSA 150
||||||||||||||||||||||||||||||||||||||||.|||||||||
+ 101 AKDGVQAQTRILFHALRKMNIPTVIFINKIDQAGVDLQSVVQSVRDKLSA 150
[EMBOSS Needle](https://www.ebi.ac.uk/Tools/psa/emboss_needle/)
+ 151 DIIIKQTVSLSPEIVLEENTDIEAWDAVIENNDELLEKYIAGEPISREKL 200
||||||||||||||||||||||||||||||||||||||||||||||||||
+ 151 DIIIKQTVSLSPEIVLEENTDIEAWDAVIENNDELLEKYIAGEPISREKL 200
See file `lr_flye_contig_820:1.0-90197.0_proteins60-61_alignment.txt`.
+ 201 AREEQQRVQDASLFPVYHGSAKNGLGIQPLMDAVTGLFQPIGEQGGAALC 250
||||||||||||||||||||||||||||||||||||||||||||||||||
+ 201 AREEQQRVQDASLFPVYHGSAKNGLGIQPLMDAVTGLFQPIGEQGGAALC 250
- contig_820:1.0-90197.0_61 matches the beginning
- contig_820:1.0-90197.0_60 matches the end
+ 251 GSVFKVEYTDCGQRLVYLRLYSGTLRLRDTVALAGREKLKITEMRIPSKG 300
||||||||||||||.|||||||||||||||||||||||||||||||||||
+ 251 GSVFKVEYTDCGQRRVYLRLYSGTLRLRDTVALAGREKLKITEMRIPSKG 300
## metaT covearge
+ 301 EIVRTDTAHKGEIVILPSDSLRLNDILGDKTQLPREMWSDVPFPMLRTTI 350
||||||||::||||||||||:||||:|||:|:|||:.|.:.|.|||||||
+ 301 EIVRTDTAYQGEIVILPSDSVRLNDVLGDQTRLPRKRWREDPLPMLRTTI 350
```bash
grep "contig_820:1.0-90197.0" mapping/metat/lr/flye/ASSEMBLY.POLISHED.sr.cov.perbase | sed -n -e '42000,46000p'
```
+ 351 TPKTAEQRDRLLDALTQIADTDPLLHYEVDSITHEIILSFLGRVQLEVVS 400
.||||.||:||||||||:|||||||..|||||||||||||||||||||||
+ 351 APKTAAQRERLLDALTQLADTDPLLRCEVDSITHEIILSFLGRVQLEVVS 400
## Contig
+ 401 ALLSEKYKLETVVKEPTVIYMERPLKAASHTIHIEVPPNPFWASIGLSVT 450
||||||||||||||||:|||||||||||||||||||||||||||||||||
+ 401 ALLSEKYKLETVVKEPSVIYMERPLKAASHTIHIEVPPNPFWASIGLSVT 450
Bases 42k to 46k:
+ 451 PLPLGSGVQYESRVSLGYLNQSFQNAVRDGIRYGLEQGLFGWNVTDCKIC 500
||.|||||||||||||||||||||||||||||||||||||||||||||||
+ 451 PLSLGSGVQYESRVSLGYLNQSFQNAVRDGIRYGLEQGLFGWNVTDCKIC 500
```bash
grep -A1 "contig_820:1.0-90197.0" assembly/lr/flye/ASSEMBLY.POLISHED.fasta | sed -r 's/(.{100})/\1\n/g' | sed -n -e '420,460p'
```
+ 501 FEYGLYYSPVSTPADFRSLAPIVLEQALKESGTQLLEPYLSFTLYAPREY 550
||||||||||||||||||||||||||||||||||||||||||.||||:||
+ 501 FEYGLYYSPVSTPADFRSLAPIVLEQALKESGTQLLEPYLSFILYAPQEY 550
```
AAACAGCCATAAGAAGTGGTTCAATATCCGTAATATCCATAATTGCCATATTAGAAACTGCTTTCGTAAAGGCTCGATTTCTTTTTAATTCTAATATACT
TTTTCTATCGGTCGCATCCGCCACACAAAATTCAATTTGTTTTGCATATTGTGATTGCCGTCTTTTAGCCAATTCTATCATTTTTTTGCTGTAATCAAAA
GCGACAACCGAAGCGCCTCTTTGTGCAAGATACGAAGAATAATTTCCATTGCCACACGCAATATCCAAAATGTAATCCGCAGGATTAGGAGATAGAAGTT
CCGTTACTTTGGGACGCACTACCTCTCTGTGAAATTCATTAGATTCGTCACCCATTGCATTATCCCAAAATTGTGCGTTCTCCTCCCAGATTTTTTTTAC
TTTCCTCTGTTCCCATGTTCTCTCCCACTCCCCAAATTTGCTTTTTTGCTTCCATTAAATCTTCCTTACTATATTCCATTGTTACCCTCCATAACTTCTG
ATTGTTGCCGTCTTGACGATTATGTATCTTTACATTACCTTCTGAAACATATGGCGCACCTTGTCCAGGCGGCTGTTTGGACGGCGGGGCTGGATGACCG
GCTGACCGACAGCGGCCTGATATCCTTTCAGCTCTGTAAGGCATACGCTCCGCCCGTTGGTGTAAAAGGCCAGATCAGTACGGTATGCCTGTATACAGCG
GGCGGGAATCTCGCCAGTAAAGACAACTTCATCCTTTTTTACCTGGGCCGTTTCGATGGTGGCACAGTATTTCGGTGCATCATGATAAGCCCTGGAAAGG
TATTCCTGGGGCGCATAGAGGGATGAAGGAGAGATAAGGTTCCAGCAGCTGCGTCCCCGATTCCTTCAATGCCTGTTCCAATACAATCGGGGCCAATGAG
CGGAAGTCCGCCGGCGTGCTGACCGGACTGTAATAAAGCCCGTATTCAAAGCAAATCTTACAGTCCGTTACGTTCCAGCCGAACAAGCCCTGCTCCAGCC
CGTAACGGATACCATCCCTGACAGCGTTTTGAAAACTCTGGTTCAAGTATCCCAGCGAAACCCGGCTCTCGTATTGTACACCGGAGCCAAGCGAGAGTGG
TGTAACAGACAGTCCTATGGATGCCCAAAACGGGTTGGGCGGCACCTCGATATGGATGGTGTGGCTGGCTGCTTTGAGCGGCCGCTCCATATAAATGACG
GAGGGTTCCTTTACCACTGTTTCAAGCTTGTATTTTTCCGACAGCAAAGCGGAAACAACCTCCAACTGCACCCGGCCCAAAAAGAAAGAATGATCTCATG
GGTGATGGAATCCACTTCGCAACGCAAAAGCGGGTCAGTATCCGCAAGTTGCGTAAGAGCGTCCAGCAGCCGTTCTCTTTGCGCTGCCGTTTTCGGCGCA
ATCGTCGTCCGCAGCATGGGGAGGGGGTCCTCGCGCCACCTTTTACGAGGGAGCCGGGTTTGGTCCCCTAATACATCGTTTAACCTCACGCTGTCGCTGG
GAAGGATAACAATTTCACCCTGATAAGCGGTGTCTGTCCGAACAATTTCCCCTTTGGATGGAATACGCATCTCTGTGATTTTCAGCTTTTCTCTCCCGGC
CAGGGCCACCGTATCCCGCAGGCGCAGCGTTCCGCTGTATAACCGTAGATAGACACGCCGCTGGCCGCAATCGGTGTACTCAACCTTGAAAACGCTGCCG
CATGGGGCGGCGCCCCCTGTTCCCCAATCGGTTGGAACAGCCCTGTCACCGCATCCATCAACGGTTGAATGCCAAGGCCATTTTTGGCGCTGCCATGATA
GACTGGGAACAGGGAGGCGTCTTGAACCCGCTGCTGTTCCTCCCGCGCAAGTTTTTCCCGGCTGATTGGTTCTCCTGCGATATACTTTTCCAATAATTCA
TCGTTATTTTCGATGACCGCATCCCATGCTTCTATGTCGGTATTTTCCTCCAGGACTATTTCCGGGGACAGCGACACCGTCTGCTTGATGATAATATCGG
CGGAGAGCTTATCCCGAACAGACTGAACCACGCTCTGCAAATCAACGCCAGCCTGGTCGATCTTGTTGATAAAGATAACGGTGGGAATGTTCATTTTCCG
CAGGGCATGGAACAGAATACGGGTCTGGGCCTGCACGCCATCTTTAGCGGAGATCACCAAGATGGCCCCATCTAAAACAGCCAAAGAGCGGTACACCTCC
GCCAAAAAATCCATGTGGCCGGGCGTATCCACAATGTTAACTTTACATCTGTGCCACTGGAAGGAAGTGACTGCCGCTTGAATGGTAATCCCACGCTGCC
GCTCCAAAAACATGGTGTCCGTCCTCGTTGTCCCTTTTTCGACGCTCCCCGGTTCTGAAATGGCTCCGCTGGCATATAGCAGGCTCTCCGTCAAGGTCGT
CTTTCCAGCGTCTACATGGGCAAGAATTCCAATATTGATTATTTTCATGTGATTGTCCTCCCTTTACAGCCCCAAAGGGCATAAAAATCCCCAGCAGTAA
AATACTTTTACCACTGGGGATTATAAGTTGCGGACATACACATATACAGCATACACCTGTTTGTGATTGCTGTTTTTGGGGATATGTCAAAATTGATAAG
GCAAAAGTATTCTTAAATTGGGTACAAAAAACTAAGCCCCTACAAAAGGAGCTATCATAATCCTTTGTTCCCACTATTTGATTATAGTTTTATTTAAGAA
TACCTTGCCGCATATTTTTTACTCCTTTTCTGGATTAAATCATTGTATCACATCAGTTTTAGGAAAGCAAGTACCTAAAAGAAATTTTTCTTCCCCTTAT
ATGTAACAATCATACCGGCTTCCTAGCGTTCAGAATGTTTTCTGCTGTCTGCTGTGGTGTTTGGTTGGAATTGTCCAACCAAAAGCCGATCCGTGGTGTT
GTCTGCATTTTACTAAATACAAATTCAATGTATACAGAAAGATATAAGGAGTGGGAGGGATTCCGCCGTAGTTGGCATTGTAGGAAAATCCAAAAGTTTA
GATTTTCCCACAATGCTTATCTTTTGGTCTTTGGTTCGGAATAGTGTAGTGCTGGCGGTCTATCTCTTGTTTTCGGTTGCTTGCTTCCTTACCGTACATG
AGCATTGGGCCGGGTTTAAACAGATCATTATTATAAATGCTCATTGGGAAAAAAAGGTTTCTAAAAAAAGAGAGAAAAATAAAAAAAAAAAAAGACTTTA
AGAGAAAAAAAAAAAGGGAAAGGGGAAGATCATACCGGAATTTGCCGGATGGAAGTTTGAACATGCTGGTCGGGCCGAAACGGCATTAATGATGTATTAC
CAGAAAACGCTGCTTCCAGGCGTTATTAGCTTGGAAAGCAGGGACTTAACTGTGAATCCTGATATATATACATTTCCTATCCCGCTCGAAATTTCGCAAA
ACGGTGGATCATTAAGTTCATGTCAAGGGGTTACCGACGAAATGGGTGCACAGCTGGCGCAACTGACCGTGAATAAAATTGCCGAGGCGGTAAGGGGGTT
TCTACAGATAAAAACAAATTGATTAAAATACAACATAAAAAGAAAAAGTTAAGGAATGAAAATATAATGCTACATACAAGAGTAAGTGGAGGTTTTATTG
CATGCTACATCATTTCCAGGTAAATACGGTATTGGAGACTTGGGAGAAACGGCAGAGTATACGGAATAGGCAGGGATAAGCTTTATGAGATGACGAGCCT
TGCTAACTGTCCGTTTGTTCTATGGGAAGGCAACCGGAGAATGATTAAACGCAGGATTTTTGATGAGTACATCGAGCAGATGTATTTGATATGATGGAGA
AAATATGGACGAGAAAATTATGGCTTACAAAGTCGAACTCCAAAAGCAAAGTGAAAACACACCGTTTTGGACAAAAAAGATTTTAACCGTTAAAGAAGCT
GCCGAATACACCGGAACCGGAAGGGCAAAAATCCGTCAAATAATTACGCAAGAAAATTGCCCTTTTACTGTGAACAACGGTACACAGATATGTGTGATCC
GGGAAGCGTTCATTGATTATCTCGATAAGCAGCTTCGCATTTTAGCTGCCATTCATTAAGACATACCTTTACAACAAGAATGTACAAAGCGGGGGGGTGA
```
+ 551 LSRAYHDAPKYCATIETVQVKKDEVVFTGEIPARCIQAYRTDLAFYTNGR 600
|||||||||||||||||.||||||||||||||||||||||||||||||||
+ 551 LSRAYHDAPKYCATIETAQVKKDEVVFTGEIPARCIQAYRTDLAFYTNGR 600
## MMSEQS2
```bash
grep "contig_820:1.0-90197.0_60" clusters.tsv
# flye__contig_2250:1.0-180537.0_144 flye__contig_820:1.0-90197.0_60
grep "contig_2250:1.0-180537.0_144" clusters.tsv
# flye__contig_2250:1.0-180537.0_144 flye__contig_2250:1.0-180537.0_144
# flye__contig_2250:1.0-180537.0_144 flye__contig_820:1.0-90197.0_60
# flye__contig_2250:1.0-180537.0_144 raven__Utg193534:1.0-988445.0_66
grep "contig_820:1.0-90197.0_61" clusters.tsv
# flye__contig_820:1.0-90197.0_61 flye__contig_820:1.0-90197.0_61
+ 601 SVCLTELKGYQATVGEPIIQPRRPNSRLDKVRHMFSKIP 639
||||||||||||.||:|:|||||||||||||||||.|:.
+ 601 SVCLTELKGYQAAVGQPVIQPRRPNSRLDKVRHMFQKVM 639
```
- 1st in a cluster with other proteins having a nudged tetW hit
- 2nd is unique
Conclusions:
- the cluster represents all perfect hits to this ARO
- only one outlier - the hit in `Flye` assembly which mapped to a different but very similar ARO
# metaP
``` bash
cat ~/tmp/gdb_amr_subset.txt | while read pid; do echo -e "${pid}: $(grep -F \'${pid}\' all_proteins_1_1_Default_Peptide_Report.txt | wc -l)"; done
# megahit__k141_88921_2: 0
# megahit__k141_44684_172: 0
# megahit__k141_37405_1: 0
# megahit__k141_59580_1: 0
# megahit__k141_105836_1: 0
# metaspades__NODE_12_length_289084_cov_116.206895_175: 0
# metaspades__NODE_3961_length_5598_cov_17.248325_7: 0
# metaspades__NODE_8958_length_2718_cov_51.879591_1: 0
# flye__contig_2250:1.0-180537.0_142: 0
# flye__contig_2250:1.0-180537.0_144: 0
# flye__contig_4930:1.0-5516.0_1: 0
# flye__contig_820:1.0-90197.0_60: 0
# flye__contig_820:1.0-90197.0_61: 0
# flye__contig_88:1.0-843327.0_578: 0
# raven__Utg192512:1.0-55869.0_70: 0
# raven__Utg193258:1.0-498612.0_132: 0
# raven__Utg193534:1.0-988445.0_66: 0
# raven__Utg193534:1.0-988445.0_67: 0
# raven__Utg194422:1.0-42550.0_3: 0
# raven__Utg194422:1.0-42550.0_4: 0
# raven__Utg196264:1.0-23463.0_40: 0
# raven__Utg196264:1.0-23463.0_41: 0
# raven__Utg197488:1.0-10276.0_3: 0
# metaspadeshybrid__NODE_1_length_1822148_cov_145.496205_549: 0
# metaspadeshybrid__NODE_230_length_104252_cov_9.790458_35: 0
# metaspadeshybrid__NODE_348_length_69013_cov_11.179239_18: 0
# metaspadeshybrid__NODE_5177_length_5598_cov_17.248325_7: 0
# operamsmegahit__opera_contig_1207_6: 0
# operamsmegahit__opera_contig_1626_1: 0
# operamsmegahit__opera_contig_17221_1: 0
# operamsmegahit__opera_contig_76903_177: 0
# operamsmetaspades__opera_contig_1579_7: 0
# operamsmetaspades__opera_contig_2775_1: 0
# operamsmetaspades__opera_contig_190543_580: 0
# TODO: to be updated
```
\ No newline at end of file
Markdown is supported
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment